PEPTIDE CORPUS
Start Free App
Peptides Conditions Goals Protocols Glossary Articles Evidence Tools Shop
Sign in Start Free App

Metabolic & Weight Management

Tesamorelin

Space-filling model of Tesamorelin

Tesamorelin is a modified copy of growth hormone-releasing hormone, prompting the pituitary to release growth hormone in its own pulses. The most interesting thing on its record is what the trials measured and what they did not. Across two randomised trials in HIV-associated lipodystrophy, visceral fat measured by CT fell by 18 and 14 percent while lean mass rose by around 1.2 kg, and the label states the drug is weight-neutral and is not indicated for weight loss. Fat moved without the scale moving. Approved since 2010 as Egrifta for that one indication, it has no approval and no trial on file in people without HIV, and it is prohibited in sport at all times despite being an approved medicine.

Last updated

Studied forVisceral fat reduction · Body composition · Recovery support
Evidence on fileFDA-approved · 1 randomised human trial · 1 human observational study
Strongest sourceEffect of Tesamorelin on Visceral Fat and Liver Fat in HIV-Infected Patients With Abdominal Fat Accumulation… (randomised human trial)

Mechanism

Stimulates pituitary GH release, IGF-1 elevation, and lipolysis.

Regulatory status

Approved by the FDA. Marketed as EGRIFTA WR, EGRIFTA SV. Earliest approval 2010-11-10. Application BLA022505.

An approval grades as rung 1 on this site, because 21 CFR 314.126 requires adequate and well-controlled human investigations and one cannot be granted without them. It covers specific indications and doses, though, and does not transfer to other uses of the same molecule.

Reported effects

What sources associate with this compound. Reported categories, not outcomes we have graded — each would need its own citation and rung.

  • Visceral fat reduction
  • Body composition
  • Recovery support

Figures

Every figure below is replotted by this site from values published in the cited paper's text or tables — the numbers are the study's, the drawing is ours, and the evidence rung on each image is the rung of its source.

Body composition and IGF-1 at 26 weeks — tesamorelin 2 mg daily — Tesamorelin 2 mg vs Placebo, Mean change from baseline (%) by measure
Data: Falutz et al. 2007, NEJM (tesamorelin in HIV lipodystrophy) · n=412 adults with HIV-associated abdominal fat accumulation; 2 mg subcutaneous daily for 26 weeks. P<0.001 for all comparisons.

Dosing on file unverified

1-2 mg daily, cycled 12–16 weeks

Reported doseVolumeDraw
Low — 1 mg0.2 mL20 units
High — 2 mg0.4 mL40 units

What that assumes. Assumes 10 mg in 2 mL (5000 mcg/mL) drawn on a U-100 barrel — the preset on this record, not a recommendation and not the only way to mix it. Change the vial mass, the diluent or the barrel and every number in this table changes. Run your own.

Carried from a source that labels it unverified, and reproduced with that label attached. A record of what is reported, not a recommendation. No citation on this page establishes it.

What is circulated about this dose. 3 claims are recorded on this page with the pages they were read from. Read what is circulated.

Reconstitution

VialDiluentConcentrationTypical doseDraw
10 mg2 mL5000 mcg/mL1000 mcg20 units

mass ÷ diluent = concentration; dose ÷ concentration = volume; volume × the syringe factor = units on the barrel (100 for U-100, 40 for U-40). Run your own numbers.

Half-life, storage & sport

Elimination half-life
8 minutes (EGRIFTA SV 1.4 mg); 11 minutes (EGRIFTA WR 1.28 mg) (human, SC) — study. FDA prescribing information, section 12.3.
Storage
Lyophilised: Original Egrifta 1 mg: 2-8C, protect from light. Egrifta SV 2 mg vial: 20-25C. Reconstituted: Use immediately; discard if not used. Do not refrigerate or freeze reconstituted solution (sterile water diluent). — source. FDA label, Egrifta / Egrifta SV.
In sport (WADA 2026)
Prohibited, at all times — named S2.2.4 (GHRH analogues). the list Prohibited despite being an approved medicine; a TUE is the only route.

The half-life on file is 10 min, measured subcutaneously. On the schedule this record states — daily — each dose has fallen to under 0.1% of its own peak by the time the next is given. Nothing accumulates, and there is no loading phase to run.

Dosed daily over 4 d, each dose normalised to the first peak.
1 compounds on one time axis, each normalised to its own peak0%25%50%75%100%0 min24 h2 d3 d4 dpeaktime from the first doseTesamorelin

The rise is not modelled and the axis is not a blood level. No absorption rate constant and no volume of distribution are on file, so each dose appears at full height the instant it is given, and the axis is percent of this compound's own peak.

Reported adverse effects

  • Injection site erythema and pruritus

    Common (1-10%)onset: Immediatereported reversible

  • Arthralgia

    Common (1-10%)onset: Weeksreported reversible

  • Peripheral edema

    Common (1-10%)onset: Weeksreported reversible

  • Reduced glucose tolerance

    Documented in trialsonset: Ongoingreported reversible

Literature on file 3

What is circulated not evidence 4

Claims passed around in community guides and vendor copy, recorded because they circulate — not because they are true. Each is shown with the page it was read from and what this record actually holds. Checked 2026-08-24.

  • unverified community data dose common agrees with the record

    The 2 mg daily label dose is circulated with a community variant: taper to 1 mg daily after a loading period, mainly on cost grounds.

    either start here or taper down from 2mg after an initial loading period

    On the record Dosing on file is 1-2 mg daily, so both figures sit inside the record; the taper strategy itself has no record.

    Source 1

  • unverified community data timing common nothing on file either way

    Off-label use for general body composition — outside the approved HIV lipodystrophy indication — is circulated as standard community practice, injected at bedtime after at least 3 hours fasted.

    The research community uses tesamorelin off-label for general body composition improvement, not just HIV lipodystrophy.

    On the record Benefits on file are visceral fat reduction, body composition and recovery support from the trial base; no bedtime-timing or fasting-window record exists.

    Source 1

  • unverified community data benefit occasional nothing on file either way

    A cognition benefit is circulated, citing a trial where 1 mg daily for 20 weeks improved executive function.

    Tesamorelin 1mg daily for 20 weeks improved executive function (P=0.005)

    On the record No cognition benefit is on file; the cited trial would need grading before any such row could exist.

    Source 1

  • unverified community data timing occasional nothing on file either way

    5-on/2-off cycling is circulated as a way to manage water retention and joint aches.

    5-on-2-off cycling

    On the record No intermittent-schedule record exists on file; the label regimen is continuous daily dosing.

    Source 1

Identity

PubChem CID 16137828 computed 3D conformer Space-filling 3D model of Tesamorelin, carbon grey, nitrogen blue, oxygen red
Built from the SMILES on this record — the atoms and bonds are exact. The shape is one computed low-energy pose, not a measured structure: a flexible peptide in solution has no single conformation, and where the SMILES leaves a stereocentre undefined the pose commits to one arbitrarily. The skeletal formula below claims connectivity and nothing more, which is what we actually know.
Skeletal formulathe canonical depiction
2D chemical structure of Tesamorelin

Drawn by PubChem from CID 16137828, the identifier on this record.

Molecular weight
5136
Molecular formula
C221H366N72O67S
CAS number
218949-48-5
PubChem CID
16137828
InChI key
QBEPNUQJQWDYKU-BMGKTWPMSA-N
Sequence
YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL
SMILES
CC/C=C/CC(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC2=CC=CC=C2)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)NCC(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(=O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(=N)N)C(=O)N[C@@H](CC(C)C)C(=O)N
InChI
InChI=1S/C221H366N72O67S/c1-25-28-30-53-163(308)260-145(92-120-54-58-122(299)59-55-120)198(343)255-116(21)179(324)276-150(96-169(316)317)199(344)256-117(22)180(325)291-172(111(16)26-2)214(359)284-147(91-119-43-31-29-32-44-119)206(351)293-174(118(23)298)215(360)285-149(95-162(230)307)205(350)289-155(104-297)210(355)280-146(93-121-56-60-123(300)61-57-121)203(348)267-130(51-41-83-248-220(240)241)186(331)266-126(46-34-36-78-223)197(342)290-171(110(14)15)212(357)283-141(87-106(6)7)183(328)252-100-166(311)258-133(63-70-157(225)302)190(335)278-144(90-109(12)13)202(347)288-152(101-294)208(353)257-115(20)178(323)262-128(49-39-81-246-218(236)237)185(330)265-125(45-33-35-77-222)189(334)277-143(89-108(10)11)201(346)279-142(88-107(8)9)200(345)272-137(66-73-160(228)305)195(340)282-151(97-170(318)319)207(352)292-173(112(17)27-3)213(358)274-139(76-85-361-24)196(341)287-153(102-295)209(354)268-131(52-42-84-249-221(242)243)187(332)270-135(64-71-158(226)303)192(337)269-132(62-69-156(224)301)182(327)251-99-165(310)259-134(67-74-167(312)313)191(336)286-154(103-296)211(356)281-148(94-161(229)306)204(349)273-136(65-72-159(227)304)193(338)271-138(68-75-168(314)315)194(339)264-124(47-37-79-244-216(232)233)181(326)250-98-164(309)253-113(18)176(321)261-127(48-38-80-245-217(234)235)184(329)254-114(19)177(322)263-129(50-40-82-247-219(238)239)188(333)275-140(175(231)320)86-105(4)5/h28-32,43-44,54-61,105-118,124-155,171-174,294-300H,25-27,33-42,45-53,62-104,222-223H2,1-24H3,(H2,224,301)(H2,225,302)(H2,226,303)(H2,227,304)(H2,228,305)(H2,229,306)(H2,230,307)(H2,231,320)(H,250,326)(H,251,327)(H,252,328)(H,253,309)(H,254,329)(H,255,343)(H,256,344)(H,257,353)(H,258,311)(H,259,310)(H,260,308)(H,261,321)(H,262,323)(H,263,322)(H,264,339)(H,265,330)(H,266,331)(H,267,348)(H,268,354)(H,269,337)(H,270,332)(H,271,338)(H,272,345)(H,273,349)(H,274,358)(H,275,333)(H,276,324)(H,277,334)(H,278,335)(H,279,346)(H,280,355)(H,281,356)(H,282,340)(H,283,357)(H,284,359)(H,285,360)(H,286,336)(H,287,341)(H,288,347)(H,289,350)(H,290,342)(H,291,325)(H,292,352)(H,293,351)(H,312,313)(H,314,315)(H,316,317)(H,318,319)(H4,232,233,244)(H4,234,235,245)(H4,236,237,246)(H4,238,239,247)(H4,240,241,248)(H4,242,243,249)/b30-28+/t111-,112-,113-,114-,115-,116-,117-,118+,124-,125-,126-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,171-,172-,173-,174-/m0/s1

Classified as

Lipolysis Stimulationmechanism
This mechanism is the source of the most common category error on the site. A record can be well supported for lipolysis and carry nothing at all for fat loss, and the two live in different fields with different rungs on the ladder at /evidence/rubric.
Growth Hormone / IGF-1 Axispathway
The lab value people actually track, IGF-1 in ng/mL, sits two steps downstream of where most of these compounds act, so a record's mechanism and its measurable marker are rarely the same thing.
Subcutaneousroute
This is the route the reconstitution arithmetic assumes. Mass divided by diluent volume gives concentration, dose divided by concentration gives volume, and volume in mL multiplied by 100 gives units on a U-100 barrel: 5 mg in 2 mL is 2.5 mg/mL, and 0.25 mg comes out at 0.1 mL, which is 10 units.

Also called

  • Tesamorelin
  • tesa

Notes unverified prose

FDA-approved (HIV); FDA-approved (Egrifta)

Not on file 0

All 8 tracked fields hold a value on this record: molecular weight and formula, CAS number, PubChem CID, amino-acid sequence, SMILES, InChI and InChI key.

Counted from the record itself, not from what a source said it was missing. 163 of 188 records still have at least one empty.

Listed prices 369

What 200 shops we track listed for Tesamorelin, read from their own public catalogues on 2026-09-14. We take no commission on these and they are not ranked by any payment — how vendors are scored.

Compare prices369 listings from 200 shops
Listed in USD
VendorSizePricePer mg
Step One Ventures 20 mg $50.00 USD $2.50/mg
BioPep 5.81 mg $17.00 USD $21.00 USD $2.93/mg
Step One Ventures 10 mg $33.50 USD $3.35/mg
Renova Peptides 20 mg $69.00 USD $3.45/mg
Novaglo Research 20 mg $75.00 USD $3.75/mg
Silverstone Labs Co 20 mg $75.00 USD $105.00 USD $3.75/mg
research1peptides 30 mg $115.00 USD $3.83/mg
RetaOne Labs 20 mg $77.00 USD $3.85/mg
RetaOne Labs 10 mg $39.00 USD $3.90/mg
VANDL Labs 20 mg $79.99 USD $4.00/mg
VANDL Labs 50 mg $199.99 USD $4.00/mg
Go Alpha Labs 20 mg $82.49 USD $109.99 USD $4.12/mg
Elite Edge Biotech 20 mg $85.00 USD $4.25/mg
research1peptides 20 mg $85.00 USD $4.25/mg
pepvidalabs 10 mg $43.70 USD $55.00 USD $4.37/mg
Peptide Partners 200 mg $898.00 USD $4.49/mg
AMC Essentials 20 mg $89.99 USD $4.50/mg
peptidegiants.com 20 mg $89.99 USD $4.50/mg
Novaglo Research 10 mg $45.00 USD $4.50/mg
Orion Peptides 10 mg $45.00 USD $4.50/mg
Peptinexia 10 mg $45.00 USD $50.00 USD $4.50/mg
research1peptides 10 mg $45.00 USD $4.50/mg
AMC Essentials 20 mg $94.99 USD $4.75/mg
ezPeps 20 mg $94.99 USD $4.75/mg
Renova Peptides 10 mg $49.00 USD $4.90/mg
Alera Research 10 mg $49.99 USD $59.99 USD $5.00/mg
Double R Labs 10 mg $49.99 USD $54.99 USD $5.00/mg
IDUN Peptides 10 mg $49.99 USD $5.00/mg
Fusion Peptide 12 mg $59.99 USD $5.00/mg
Modified Aminos 20 mg $99.99 USD $5.00/mg
Forge Performance Co 16 mg $80.00 USD $5.00/mg
Treasure Coast Solutions 10 mg $51.00 USD $5.10/mg
Peptide Partners 100 mg $514.00 USD $5.14/mg
Puratek Peptides 20 mg $104.95 USD $5.25/mg
Go Alpha Labs 10 mg $52.49 USD $69.99 USD $5.25/mg
PH Bio Labs 10 mg $52.50 USD $5.25/mg
Valor Peptides 32 mg $169.99 USD $5.31/mg
Ion Peptide 20 mg $109.00 USD $5.45/mg
Puratek Peptides 10 mg $54.95 USD $5.50/mg
Vital Core Research 10 mg $54.95 USD $5.50/mg
Felix Chemical Supply 10 mg $54.99 USD $5.50/mg
Fusion Peptide 10 mg $54.99 USD $5.50/mg
TCORE BIOTECH 10 mg $54.99 USD $5.50/mg
ezPeps 12 mg $65.99 USD $5.50/mg
atomiklabz 10 mg $55.00 USD $5.50/mg
Elite Edge Biotech 10 mg $55.00 USD $5.50/mg
GenPeptide 10 mg $55.00 USD $5.50/mg
Hydro Research 10 mg $55.00 USD $99.00 USD $5.50/mg
Optima Supply 10 mg $55.00 USD $5.50/mg
peptidegiants.com 10 mg $55.00 USD $5.50/mg
Silverstone Labs Co 10 mg $55.00 USD $99.00 USD $5.50/mg
atomiklabz 20 mg $110.00 USD $5.50/mg
Peptide Partners 50 mg $287.00 USD $5.74/mg
Transforma Peptides 5 mg $29.00 USD $5.80/mg
Transforma Peptides 10 mg $58.00 USD $5.80/mg
Legendary Peptides 10 mg $59.00 USD $5.90/mg
Southern Aminos 10 mg $59.25 USD $79.00 USD $5.92/mg
Verified Peptides 20 mg $119.00 USD $5.95/mg
Peptides Warehouse 10 mg $59.59 USD $5.96/mg
Pure Peptide Labs 5 mg $29.95 USD $5.99/mg
Pure Peptide Labs 10 mg $59.95 USD $6.00/mg
Athena Peptides 10 mg $59.99 USD $6.00/mg
Evolve BioPep 10 mg $59.99 USD $6.00/mg
Modified Aminos 10 mg $59.99 USD $6.00/mg
Oneday Compounds 10 mg $59.99 USD $74.99 USD $6.00/mg
Valor Peptides 10 mg $59.99 USD $6.00/mg
PeptiFy Labs 20 mg $119.99 USD $6.00/mg
Forge Performance Co 10 mg $60.00 USD $6.00/mg
Peptide Crafters 10 mg $60.00 USD $65.00 USD $6.00/mg
PeakForm Peptides 15 mg $90.00 USD $6.00/mg
Liberty Peptides 20 mg $120.00 USD $6.00/mg
Royal Peptides 20 mg $120.00 USD $6.00/mg
Peptide Partners 20 mg $122.00 USD $6.10/mg
Penguin Peptides - 20 mg $125.00 USD $6.25/mg
ezPeps 10 mg $62.99 USD $6.30/mg
Peptira 30 mg $189.00 USD $6.30/mg
Paramount Peptides 10 mg $64.60 USD $6.46/mg
Elite Research Labs (.com lab) 20 mg $129.99 USD $6.50/mg
Solyn 10 mg $65.00 USD $6.50/mg
Zenith Biopeptides 10 mg $65.00 USD $6.50/mg
Peptides.GG 20 mg $130.00 USD $6.50/mg
Chameleon Peptides 10 mg $65.70 USD $6.57/mg
Regentide 5 mg $32.99 USD $6.60/mg
Triumphant Labs 10 mg $66.00 USD $6.60/mg
Liberty Peptides 10 mg $67.00 USD $6.70/mg
PeakForm Peptides 20 mg $135.00 USD $6.75/mg
Athena Peptides 5 mg $34.00 USD $6.80/mg
Ameano Peptides 10 mg $68.00 USD $6.80/mg
EZ Peptides 10 mg $68.00 USD $6.80/mg
Peptides.GG 10 mg $68.00 USD $6.80/mg
Ion Peptide 10 mg $69.95 USD $7.00/mg
Nation Peptides 10 mg $69.99 USD $7.00/mg
PSPeptides 10 mg $69.99 USD $7.00/mg
PH Bio Labs 5 mg $35.00 USD $7.00/mg
Honest Peptide 10 mg $70.00 USD $100.00 USD $7.00/mg
Longevity Pro Labs 10 mg $70.00 USD $7.00/mg
PeakForce Labs 10 mg $70.00 USD $132.00 USD $7.00/mg
PeakForm Peptides 10 mg $70.00 USD $7.00/mg
Peptide Plugs 10 mg $70.00 USD $7.00/mg
Purus Peptides 10 mg $70.00 USD $7.00/mg
Certified Peptides 20 mg $140.00 USD $7.00/mg
Nurapeptide 20 mg $140.00 USD $7.00/mg
ONYX BIOLABS 20 mg $141.99 USD $7.10/mg
Cosmic Peptides 10 mg $71.99 USD $7.20/mg
PeptiFy Labs 10 mg $71.99 USD $7.20/mg
utahresearchlab 10 mg $72.00 USD $7.20/mg
PeakForce Labs 20 mg $145.00 USD $210.00 USD $7.25/mg
Biotech Peptides 10 mg $73.00 USD $7.30/mg
Pure Health Peptides (GLP Supplies) 10 mg $73.00 USD $7.30/mg
Nationwide Peptides 20 mg $146.00 USD $7.30/mg
Oasis Labs 10 mg $74.00 USD $7.40/mg
Elite Research Labs (.com lab) 10 mg $74.99 USD $7.50/mg
Rivn Peptides 10 mg $74.99 USD $7.50/mg
Soma Chems 10 mg $74.99 USD $7.50/mg
Alpha Omega Peptide 10 mg $75.00 USD $7.50/mg
Blank Peptides 10 mg $75.00 USD $7.50/mg
milehighpeptides.com 10 mg $75.00 USD $7.50/mg
My GLP 1 Store 10 mg $75.00 USD $7.50/mg
Penguin Peptides - 10 mg $75.00 USD $7.50/mg
Rejuven8 Peptides 10 mg $75.00 USD $7.50/mg
Royal Peptides 10 mg $75.00 USD $7.50/mg
SimplePeptide 10 mg $75.00 USD $7.50/mg
Longevity Pro Labs 12 mg $90.00 USD $7.50/mg
Biotech Peptides 5 mg $38.00 USD $7.60/mg
ONYX BIOLABS 10 mg $77.49 USD $7.75/mg
Protide Health 20 mg $155.00 USD $7.75/mg
Guru Peptides 5 mg $38.99 USD $49.99 USD $7.80/mg
Treasure Coast Solutions 5 mg $39.00 USD $7.80/mg
Core Peptides 10 mg $79.00 USD $7.90/mg
NeuroPept Labs 10 mg $79.00 USD $7.90/mg
Dynotides 10 mg $79.97 USD $88.00 USD $8.00/mg
Elite Research Labs (.com lab) 5 mg $39.99 USD $8.00/mg
Orbitrex Peptides 10 mg $79.99 USD $8.00/mg
Florida Peptides 10 mg $80.00 USD $8.00/mg
Nurapeptide 10 mg $80.00 USD $8.00/mg
Prime Peptides 10 mg $80.00 USD $8.00/mg
Try Hero Research 10 mg $80.00 USD $100.00 USD $8.00/mg
Soma - 10 mg $80.00 USD $8.00/mg
Florida Peptides 20 mg $160.00 USD $8.00/mg
peaklabpeptides.com 10 mg $82.00 USD $8.20/mg
Red Rock Peptides 10 mg $82.00 USD $8.20/mg
Amp Peptides 20 mg $165.00 USD $8.25/mg
Arizona Peptides (.us) 15 mg $125.00 USD $8.33/mg
Arizona Peptides USA 15 mg $125.00 USD $8.33/mg
Vital Core Research 5 mg $41.99 USD $8.40/mg
Pepsynth Labs 5 mg $42.00 USD $8.40/mg
Life Peptides 10 mg $84.95 USD $8.49/mg
NuRev Peptides 10 mg $84.99 USD $8.50/mg
novapeptidesupply 20 mg $169.99 USD $8.50/mg
Protide Health 10 mg $85.00 USD $8.50/mg
Pepsynth Labs 20 mg $170.00 USD $8.50/mg
Felix Chemical Supply 5 mg $42.99 USD $8.60/mg
TCORE BIOTECH 5 mg $42.99 USD $8.60/mg
Sentinel Valor 10 mg $85.99 USD $8.60/mg
Core Peptides 5 mg $43.00 USD $8.60/mg
Purus Peptides 11 mg $95.00 USD $8.64/mg
Rivn Peptides 5 mg $43.99 USD $8.80/mg
Nationwide Peptides 10 mg $88.00 USD $8.80/mg
Certified Peptides 10 mg $89.00 USD $8.90/mg
Peptira 10 mg $89.00 USD $8.90/mg
AminoVault 10 mg $89.25 USD $8.93/mg
novapeptidesupply 10 mg $89.99 USD $9.00/mg
Ion Peptide 5 mg $45.00 USD $9.00/mg
PeakForm Peptides 5 mg $45.00 USD $9.00/mg
Penguin Peptides - 5 mg $45.00 USD $9.00/mg
Rejuven8 Peptides 5 mg $45.00 USD $9.00/mg
aminousa 10 mg $90.00 USD $9.00/mg
Arizona Peptides (.us) 10 mg $90.00 USD $9.00/mg
Arizona Peptides USA 10 mg $90.00 USD $9.00/mg
Orion Peptides 10 mg $90.00 USD $9.00/mg
Secra Labs 10 mg $90.00 USD $9.00/mg
Cosmic Peptides 5 mg $45.99 USD $9.20/mg
Fusion Peptide 5 mg $45.99 USD $9.20/mg
Sentinel Valor 5 mg $45.99 USD $9.20/mg
BioGenix Peptides 10 mg $92.00 USD $9.20/mg
Licensed Peptides 20 mg $184.99 USD $9.25/mg
Modern Peptides 20 mg $185.00 USD $9.25/mg
Nationwide Peptides 5 mg $47.00 USD $9.40/mg
Pure Health Peptides (GLP Supplies) 5 mg $47.00 USD $9.40/mg
Titan X Research 10 mg $95.00 USD $9.50/mg
Oath Peptides 20 mg $190.00 USD $9.50/mg
Oath Research 20 mg $190.00 USD $9.50/mg
Sigma Compounds 10 mg $97.00 USD $9.70/mg
Peptides Warehouse 5 mg $49.59 USD $9.92/mg
Peptide Pros ships worldwide 5 mg $49.85 USD $72.00 USD $9.97/mg
Kylo Peptides 10 mg $99.95 USD $9.99/mg
novapeptidesupply 5 mg $49.99 USD $10.00/mg
Soma Chems 5 mg $49.99 USD $10.00/mg
Titan X Research 5 mg $49.99 USD $10.00/mg
BioPure Peptides 10 mg $99.99 USD $10.00/mg
PSPeptides 10 mg $99.99 USD $10.00/mg
Pure Lab Peptides 20 mg $199.99 USD $10.00/mg
Ascension Peptides 5 mg $50.00 USD $89.99 USD $10.00/mg
Amp Peptides 10 mg $100.00 USD $10.00/mg
Ignite Research LLC 10 mg $100.00 USD $10.00/mg
Trulab Peptides 10 mg $100.00 USD $10.00/mg
Valkyrie Peptides 10 mg $100.00 USD $10.00/mg
Grey Research Peptides 20 mg $200.00 USD $10.00/mg
Modern Peptides 10 mg $102.00 USD $10.20/mg
Peptide Works 10 mg $108.15 USD $10.81/mg
Longevity Peptide Labs 10 mg $109.00 USD $10.90/mg
LabTrust Peptides 10 mg $109.99 USD $129.99 USD $11.00/mg
milehighpeptides.com 5 mg $55.00 USD $11.00/mg
Peptide Works 5 mg $56.30 USD $11.26/mg
Adapt Peptides 10 mg $115.00 USD $11.50/mg
Penguin Peptides - 10 mg $119.00 USD $11.90/mg
Vertex Labs 10 mg $119.00 USD $11.90/mg
PSPeptides 5 mg $59.99 USD $12.00/mg
GenX Peptides 2 mg $24.00 USD $12.00/mg
Focused Peptides 10 mg $120.00 USD $12.00/mg
Oath Peptides 10 mg $120.00 USD $12.00/mg
Oath Research 10 mg $120.00 USD $12.00/mg
Nootropic Source 2 mg $24.95 USD $12.47/mg
BioPure Peptides 6 mg $74.99 USD $12.50/mg
Pure Bio Labs 10 mg $124.99 USD $12.50/mg
Grey Research Peptides 10 mg $125.00 USD $12.50/mg
peaklabpeptides.com 5 mg $63.00 USD $12.60/mg
Pure Lab Peptides 10 mg $129.99 USD $13.00/mg
Adapt Peptides 5 mg $65.00 USD $13.00/mg
aminousa 5 mg $65.00 USD $13.00/mg
Licensed Peptides 10 mg $130.99 USD $13.10/mg
Raw Amino 10 mg $135.00 USD $13.50/mg
Raw Amino 5 mg $69.00 USD $13.80/mg
Perform Peptides 10 mg $139.00 USD $13.90/mg
Swiss Chems ships worldwide 2 mg $27.95 USD $13.97/mg
Pure Lab Peptides 5 mg $69.99 USD $14.00/mg
PeptidesKingdom 10 mg $140.00 USD $14.00/mg
Peptide Works 2 mg $29.24 USD $14.62/mg
aminousa 2 mg $30.00 USD $15.00/mg
Oath Peptides 5 mg $75.00 USD $15.00/mg
Oath Research 5 mg $75.00 USD $15.00/mg
PeptidesKingdom 5 mg $75.00 USD $15.00/mg
USA Peptide Sciences 5 mg $75.00 USD $15.00/mg
Amino Supply 10 mg $150.00 USD $15.00/mg
Improved Peptides 10 mg $150.00 USD $15.00/mg
Almighty Peptides 5 mg $77.00 USD $15.40/mg
Vertex Labs 5 mg $79.00 USD $15.80/mg
A2Z Peptides 10 mg $158.00 USD $15.80/mg
Regentide 10 mg $159.99 USD $16.00/mg
Focused Peptides 5 mg $80.00 USD $16.00/mg
AminoVault 10 mg $160.65 USD $16.07/mg
Pure Bio Labs 5 mg $80.99 USD $16.20/mg
Pivot labs 10 mg $169.95 USD $17.00/mg
ResearchChemical.com 5 mg $84.99 USD $17.00/mg
Sports Technology Labs 5 mg $84.99 USD $17.00/mg
Trulab Peptides 5 mg $85.00 USD $17.00/mg
Pivot labs 5 mg $87.99 USD $17.60/mg
Peptides Warehouse 2 mg $45.59 USD $22.80/mg
Trulab Peptides 2 mg $49.00 USD $24.50/mg
Umbrella Labs 2 mg $50.99 USD $25.50/mg
Ion Peptide 3 mg $99.00 USD $33.00/mg
Umbrella Labs 2 mg $69.99 USD $34.99/mg
Royal Peptides 20 mg $700.00 USD $35.00/mg
LIVV 5 mg $207.50 USD $41.50/mg
Royal Peptides 10 mg $530.00 USD $53.00/mg
Sentinel Valor 10 mg $649.00 USD $64.90/mg
Sentinel Valor 5 mg $399.00 USD $79.80/mg
Oasis Labs 1 mg $98.00 USD $98.00/mg
Eternal Peptides size not listed $33.99 USD $45.99 USD —
Silverstone Labs Peptides size not listed $49.00 USD —
NuRev Peptides size not listed $54.99 USD —
Eternal Peptides size not listed $57.99 USD $82.99 USD —
Coastal Peptides size not listed $65.00 USD $70.00 USD —
Midwest Peptide size not listed $69.99 USD —
Vortex Research size not listed $69.99 USD $85.00 USD —
Modern Aminos size not listed $71.00 USD —
Puratek Peptides size not listed $74.95 USD —
Ventra Sciences size not listed $75.00 USD —
Mile High Compounds size not listed $79.99 USD $99.99 USD —
Jade Nexus size not listed $81.00 USD $90.00 USD —
Improved Peptides size not listed $105.00 USD —
Vertex Labs size not listed $109.00 USD —
Mile High Compounds size not listed $109.99 USD $139.99 USD —
HEEZ Research size not listed $115.00 USD —
PeptideTest size not listed $250.00 USD —
Spartan Peptides size not listed $286.20 USD —
Royal Peptides size not listed $435.00 USD —
Listed in CAD
VendorSizePricePer mg
Peptide Shop Canada 10 mg $62.50 CAD $6.25/mg
Peptide Supply Online 20 mg $130.00 CAD $6.50/mg
Red Leaf Research Labs 20 mg $139.99 CAD $7.00/mg
Peptide Shop Canada 5 mg $35.00 CAD $7.00/mg
Great Northern Peptides 20 mg $140.00 CAD $7.00/mg
Maple Research Labs 20 mg $150.00 CAD $7.50/mg
Great Northern Peptides 10 mg $80.00 CAD $8.00/mg
Red Leaf Research Labs 10 mg $80.00 CAD $8.00/mg
Peptide Supply Online 10 mg $85.00 CAD $8.50/mg
The Peptide Labs 10 mg $85.00 CAD $8.50/mg
Riptide Peptides 10 mg $89.00 CAD $8.90/mg
Nox Peptides 10 mg $89.99 CAD $9.00/mg
VPeptide Canada 10 mg $89.99 CAD $9.00/mg
Maple Research Labs 5 mg $45.00 CAD $9.00/mg
Maple Research Labs 10 mg $90.00 CAD $9.00/mg
Northern Peptides 10 mg $90.00 CAD $9.00/mg
Peptigo 10 mg $90.00 CAD $9.00/mg
Panda Peptide 10 mg $94.99 CAD $9.50/mg
Peptide Cart 10 mg $94.99 CAD $9.50/mg
PeptideProCanada 10 mg $95.00 CAD $125.00 CAD $9.50/mg
Core Peptides Canada 10 mg $97.41 CAD $9.74/mg
BioPerform 10 mg $99.99 CAD $10.00/mg
The Peptide CA 10 mg $99.99 CAD $10.00/mg
The Peptide Labs 5 mg $50.00 CAD $10.00/mg
Core Peptides Canada 5 mg $53.02 CAD $10.60/mg
Black Helix Labs 10 mg $110.00 CAD $130.00 CAD $11.00/mg
Toronto Peptides 10 mg $110.00 CAD $11.00/mg
Luxara Labs 20 mg $220.00 CAD $11.00/mg
Canada Steroid Depot 20 mg $225.00 CAD $11.25/mg
ExoLabz 10 mg $119.99 CAD $12.00/mg
Luxara Labs 10 mg $120.00 CAD $12.00/mg
Pacific Peptides 10 mg $125.00 CAD $12.50/mg
Panda Peptide 5 mg $64.99 CAD $13.00/mg
Amino Peptides 10 mg $129.99 CAD $13.00/mg
Ronin Peptides 10 mg $135.00 CAD $13.50/mg
Ronin Peptides 20 mg $281.99 CAD $14.10/mg
Polar Peptides 20 mg $289.99 CAD $14.50/mg
Polar Peptides 15 mg $219.99 CAD $14.67/mg
Canada Peptide 5 mg $75.99 CAD $15.20/mg
Polar Peptides 10 mg $159.99 CAD $16.00/mg
Toronto Peptides 5 mg $80.00 CAD $105.00 CAD $16.00/mg
Revico Labs 10 mg $190.00 CAD $19.00/mg
Polar Peptides 5 mg $99.99 CAD $20.00/mg
Canada Steroid Depot 5 mg $104.74 CAD $20.95/mg
MaplePep size not listed $55.00 CAD —
Great Northern Peptides size not listed $80.00 CAD —
Maple Leaf Peptides size not listed $94.95 CAD —
SARMs Revolution Lab size not listed $95.99 CAD —
NCRP Canada size not listed $110.00 CAD —
Durham Peptides size not listed $159.99 CAD —
Listed in GBP
VendorSizePricePer mg
Be Better Peptides 10 mg £44.99 GBP £4.50/mg
UK Peptide Supply 10 mg £49.99 GBP £5.00/mg
UK Peptide Supply 5 mg £32.99 GBP £6.60/mg
Direct Peptides Canada 10 mg £89.29 GBP £8.93/mg
Direct Peptides USA 10 mg £89.29 GBP £8.93/mg
Pharma Lab Global Canada 10 mg £89.85 GBP £8.98/mg
Direct Peptides Canada 5 mg £46.48 GBP £9.30/mg
Direct Peptides USA 5 mg £46.48 GBP £9.30/mg
Pharma Lab Global Canada 5 mg £46.84 GBP £9.37/mg
Direct Peptides Canada 10 mg £98.27 GBP £9.83/mg
Direct Peptides USA 10 mg £98.27 GBP £9.83/mg
Pharma Lab Global Canada 10 mg £98.83 GBP £9.88/mg
Direct Peptides Canada 5 mg £55.46 GBP £11.09/mg
Direct Peptides USA 5 mg £55.46 GBP £11.09/mg
Pharma Lab Global Canada 5 mg £55.82 GBP £11.16/mg
Direct Peptides Canada 2 mg £24.14 GBP £12.07/mg
Direct Peptides USA 2 mg £24.14 GBP £12.07/mg
Pharma Lab Global Canada 2 mg £24.67 GBP £12.34/mg
Pharma Lab Global Canada 2 mg £27.80 GBP £13.90/mg
Direct Peptides Canada 2 mg £28.34 GBP £14.17/mg
Direct Peptides USA 2 mg £28.34 GBP £14.17/mg
Direct Peptides Canada 2 mg £33.12 GBP £16.56/mg
Direct Peptides USA 2 mg £33.12 GBP £16.56/mg
Pharma Lab Global Canada 2 mg £33.65 GBP £16.82/mg
Pharma Lab Global Canada 2 mg £54.05 GBP £27.02/mg
Direct Peptides Canada 2 mg £54.59 GBP £27.30/mg
Direct Peptides USA 2 mg £54.59 GBP £27.30/mg
Pharma Lab Global Canada 2 mg £55.60 GBP £27.80/mg
Direct Peptides Canada 2 mg £56.68 GBP £28.34/mg
Direct Peptides USA 2 mg £56.68 GBP £28.34/mg
Pharma Lab Global Canada 2 mg £75.06 GBP £37.53/mg
Direct Peptides Canada 2 mg £76.52 GBP £38.26/mg
Direct Peptides USA 2 mg £76.52 GBP £38.26/mg
Pharma Lab Global Canada size not listed £31.19 GBP —
Direct Peptides Canada size not listed £31.49 GBP —
Direct Peptides USA size not listed £31.49 GBP —
Pharma Lab Global Canada size not listed £57.38 GBP —
Direct Peptides Canada size not listed £57.98 GBP —
Direct Peptides USA size not listed £57.98 GBP —
Listed in AUD
VendorSizePricePer mg
Synthro Lab 10 mg 107.88 AUD 10.79/mg
Listed in ZAR
VendorSizePricePer mg
Noventra Pharma 10 mg 1400.00 ZAR 140.00/mg
Currency not stated by the vendor — these are not compared with any priced row
VendorSizePricePer mg
Apex Peptides size not listed 79.00 (currency not stated) —

Prices are the vendor's own listing, reproduced with the date we read it — never converted between currencies, and compared per milligram only where the vendor states the vial size.

Share this record

Share card for Tesamorelin: structure, evidence rung and sources on file
www.peptidecorpus.com/peptides/tesamorelin