PEPTIDE CORPUS
Start Free App
Peptides Conditions Goals Protocols Glossary Articles Evidence Tools Shop
Sign in Start Free App

Metabolic & Weight Management

Lixisenatide

Space-filling model of Lixisenatide

Lixisenatide runs against the trend of its own class. Where every other GLP-1 (glucagon-like peptide-1) drug was engineered to last longer, this one is short-acting on purpose, aimed at the glucose spike after a meal rather than at round-the-clock control, and head to head against liraglutide over eight weeks it cut the four-hour post-breakfast glucose curve further by slowing the stomach more. In the United States it is approved as part of Soliqua, a fixed combination with insulin glargine. Its evidence on file is entirely randomised, including ELIXA, which followed 6,068 people after an acute coronary syndrome and found neither an increase nor a reduction in cardiovascular events, and, unexpectedly for this class, a phase 2 trial in early Parkinson's disease.

Last updated

Studied forPostprandial glucose control · Glycaemic control research · Body weight change data
Evidence on fileFDA-approved · 3 randomised human trials
Strongest sourceNCT00763815: A Randomized, Double-blind, Placebo-controlled, 2-arm Parallel-group, Multicenter Study With a 2… (randomised human trial)

Mechanism

Exendin-4-derived GLP-1 receptor agonist that raises glucose-dependent insulin release, lowers glucagon, and markedly slows gastric emptying.

Regulatory status

Approved by the FDA. Marketed as SOLIQUA 100/33. Earliest approval 2016-11-21. Application BLA208673.

An approval grades as rung 1 on this site, because 21 CFR 314.126 requires adequate and well-controlled human investigations and one cannot be granted without them. It covers specific indications and doses, though, and does not transfer to other uses of the same molecule.

Reported effects

What sources associate with this compound. Reported categories, not outcomes we have graded — each would need its own citation and rung.

  • Postprandial glucose control
  • Glycaemic control research
  • Body weight change data

Dosing on file unverified

10 - 20 mcg/day

Carried from a source that labels it unverified, and reproduced with that label attached. A record of what is reported, not a recommendation. No citation on this page establishes it.

What is circulated about this dose. 2 claims are recorded on this page with the pages they were read from. Read what is circulated.

Half-life, storage & sport

Elimination half-life
approximately 3 hours (human, SC) — study. Read from the SOLIQUA 100/33 label, clinical pharmacology. Adlyxin, the standalone product, is no longer marketed in the US, so lixisenatide's pharmacokinetics are published only in the combination document. This is the half-life of the peptide, not the duration of its effect on blood glucose.

The half-life on file is 3 h, measured subcutaneously. On the schedule this record states — daily — each dose has fallen to 0.39% of its own peak by the time the next is given. Nothing accumulates, and there is no loading phase to run.

Dosed daily over 4 d, each dose normalised to the first peak.
1 compounds on one time axis, each normalised to its own peak0%25%50%75%100%0 min24 h2 d3 d4 dpeaktime from the first doseLixisenatide

The rise is not modelled and the axis is not a blood level. No absorption rate constant and no volume of distribution are on file, so each dose appears at full height the instant it is given, and the axis is percent of this compound's own peak.

Literature on file 4

What is circulated not evidence 3

Claims passed around in community guides and vendor copy, recorded because they circulate — not because they are true. Each is shown with the page it was read from and what this record actually holds. Checked 2026-08-24.

  • unverified community data dose occasional nothing on file either way

    Peptide calculator sites list lixisenatide alongside grey-market compounds with the label protocol restated: 10 mcg daily for 14 days, then 20 mcg maintenance, one hour before the first meal.

    10 mcg for 14 days, then increase to 20 mcg maintenance.

    On the record No dosing range is on file for lixisenatide. The circulated figures are the Adlyxin label repeated, not a community invention.

    Source 1

  • unverified community data timing occasional nothing on file either way

    A roughly 3-hour half-life is circulated on calculator pages.

    Half-Life~3 hours

    On the record No pharmacokinetic record exists on file for lixisenatide.

    Source 1

  • unverified community data sourcing fringe agrees with the record

    Community and vendor coverage of lixisenatide is thin: no dedicated dosing guides, reconstitution charts or forum protocols were found on the aggregator sites that cover every other GLP-1, and the compound circulates mainly as a label restatement.

    Once daily (SC, 1 hour before first meal)

    On the record Consistent with the record's thin holdings: benefits rows exist but no dosing, storage or PK is on file.

    Source 1

Identity

PubChem CID 90472060 computed 3D conformer Space-filling 3D model of Lixisenatide, carbon grey, nitrogen blue, oxygen red
Built from the SMILES on this record — the atoms and bonds are exact. The shape is one computed low-energy pose, not a measured structure: a flexible peptide in solution has no single conformation, and where the SMILES leaves a stereocentre undefined the pose commits to one arbitrarily. The skeletal formula below claims connectivity and nothing more, which is what we actually know.
Skeletal formulathe canonical depiction
2D chemical structure of Lixisenatide

Drawn by PubChem from CID 90472060, the identifier on this record.

Molecular weight
4858
Molecular formula
C215H347N61O65S
CAS number
320367-13-3
PubChem CID
90472060
UniProt
P43220 (Target)
InChI key
XVVOERDUTLJJHN-IAEQDCLQSA-N
Sequence
HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPSKKKKKK
SMILES
CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)N[C@@H](CC1=CNC2=CC=CC=C21)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(=O)N)C(=O)NCC(=O)NCC(=O)N3CCC[C@H]3C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N4CCC[C@H]4C(=O)N5CCC[C@H]5C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N)NC(=O)[C@H](CC6=CC=CC=C6)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(=O)O)NC(=O)[C@H](CO)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC7=CC=CC=C7)NC(=O)[C@H]([C@@H](C)O)NC(=O)CNC(=O)[C@H](CCC(=O)O)NC(=O)CNC(=O)[C@H](CC8=CNC=N8)N
InChI
InChI=1S/C215H347N61O65S/c1-16-115(10)173(210(337)256-141(68-74-170(299)300)194(321)261-148(94-122-98-232-126-50-24-23-49-124(122)126)199(326)258-143(89-111(2)3)196(323)247-134(58-32-40-83-223)189(316)262-149(96-160(226)285)180(307)235-100-161(286)233-104-165(290)274-85-42-60-156(274)207(334)267-154(108-280)206(333)265-151(105-277)181(308)237-101-162(287)239-117(12)213(340)276-87-44-62-158(276)214(341)275-86-43-61-157(275)208(335)268-153(107-279)204(331)249-132(56-30-38-81-221)187(314)246-131(55-29-37-80-220)186(313)245-130(54-28-36-79-219)185(312)244-129(53-27-35-78-218)184(311)243-128(52-26-34-77-217)183(310)242-127(176(227)303)51-25-33-76-216)272-201(328)146(92-120-45-19-17-20-46-120)260-197(324)144(90-112(4)5)257-190(317)135(59-41-84-231-215(228)229)255-209(336)172(114(8)9)271-177(304)116(11)240-182(309)138(65-71-167(293)294)251-192(319)139(66-72-168(295)296)252-193(320)140(67-73-169(297)298)253-195(322)142(75-88-342-15)254-191(318)137(63-69-159(225)284)250-188(315)133(57-31-39-82-222)248-203(330)152(106-278)266-198(325)145(91-113(6)7)259-200(327)150(97-171(301)302)263-205(332)155(109-281)269-212(339)175(119(14)283)273-202(329)147(93-121-47-21-18-22-48-121)264-211(338)174(118(13)282)270-164(289)103-236-179(306)136(64-70-166(291)292)241-163(288)102-234-178(305)125(224)95-123-99-230-110-238-123/h17-24,45-50,98-99,110-119,125,127-158,172-175,232,277-283H,16,25-44,51-97,100-109,216-224H2,1-15H3,(H2,225,284)(H2,226,285)(H2,227,303)(H,230,238)(H,233,286)(H,234,305)(H,235,307)(H,236,306)(H,237,308)(H,239,287)(H,240,309)(H,241,288)(H,242,310)(H,243,311)(H,244,312)(H,245,313)(H,246,314)(H,247,323)(H,248,330)(H,249,331)(H,250,315)(H,251,319)(H,252,320)(H,253,322)(H,254,318)(H,255,336)(H,256,337)(H,257,317)(H,258,326)(H,259,327)(H,260,324)(H,261,321)(H,262,316)(H,263,332)(H,264,338)(H,265,333)(H,266,325)(H,267,334)(H,268,335)(H,269,339)(H,270,289)(H,271,304)(H,272,328)(H,273,329)(H,291,292)(H,293,294)(H,295,296)(H,297,298)(H,299,300)(H,301,302)(H4,228,229,231)/t115-,116-,117-,118+,119+,125-,127-,128-,129-,130-,131-,132-,133-,134-,135-,136-,137-,138-,139-,140-,141-,142-,143-,144-,145-,146-,147-,148-,149-,150-,151-,152-,153-,154-,155-,156-,157-,158-,172-,173-,174-,175-/m0/s1

Caveat on these identifiers

P43220 is the GLP-1 RECEPTOR, not the drug itself.

Notes unverified prose

FDA-approved; NCT00763815; NCT00763815 (GETGOAL-P)

Not on file 0

All 8 tracked fields hold a value on this record: molecular weight and formula, CAS number, PubChem CID, amino-acid sequence, SMILES, InChI and InChI key.

Counted from the record itself, not from what a source said it was missing. 163 of 188 records still have at least one empty.

Share this record

Share card for Lixisenatide: structure, evidence rung and sources on file
www.peptidecorpus.com/peptides/lixisenatide