IGF-1

Mechanism

Activates the IGF-1 receptor tyrosine kinase, driving PI3K/Akt and MAPK signalling; binds insulin receptors weakly.

Reported effects

What sources associate with this compound. Reported categories, not outcomes we have graded — each would need its own citation and rung.

• Statural growth research
• Anabolic signalling context
• Glucose uptake effects

Half-life, storage & sport

Elimination half-life

6 h (human, SC) — study. Clinical pharmacology in drug development 2025; children and adolescents with primary IGF-1 deficiency, single subcutaneous 0.04 mg/kg dose of mecasermin; n and sex not stated; exogenous recombinant IGF-1, not the free endogenous peptide.

The half-life on file is 6 h, measured subcutaneously. On the schedule this record states — twice daily — each dose is still at 25% of its own peak when the next is given, so the doses overlap: the peaks build to 1.33× the first.

The rise is not modelled and the axis is not a blood level. No absorption rate constant and no volume of distribution are on file, so each dose appears at full height the instant it is given, and the axis is percent of this compound's own peak.

Literature on file 8

• human observational
  Marked and reversible circulating insulin-like growth factor-1 elevation during teprotumumab N01 treatment for thyroid eye disease with limited correspondence to glycemic changes. graded on: an observational human design — read from the indexed abstract — “retrospective”
• human observational
  Serum insulin-like growth factor-1 concentrations are not reduced in Pomeranian dogs with Alopecia X: a case-control study. graded on: an observational human design — “case-control”
• human case series
  Pharmacogenetic hypersensitivity to somatropin in a child with severe growth hormone deficiency and MC4R p.V166I variant. graded on: single case report of somatropin hypersensitivity with MC4R variant — read from the abstract — “abstract review”
• human observational
  NCT00673309: Assessment of Mechanisms of Improved Wound Healing of Anabolic Agents and Diet in Severely Burned Patients graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT01207908: IGF-1 Therapy and Muscle Function in Duchenne Muscular Dystrophy graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT01525901: A Double-Blind Placebo-Controlled Crossover Trial of Insulin-Like Growth Factor-1 (IGF-1) in Children and Adolescents With 22q13 Deletion Syndrome(Phelan-McDermid Syndrome) graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT00330668: Recombinant Human Insulin-Like Growth Factor-1 (IGF-1) Treatment of Children With Growth Failure Associated With Primary IGF-1 Deficiency: An Open-Label, Multi-Center, Extension Study graded on: a registered clinical study — “clinicaltrials.gov”
• human observational
  NCT00684957: Differential Effects of rhGH vs. rhIGF-1 on Cardiovascular Risk Factors in Adult Patients With Growth Hormone Deficiency graded on: a registered clinical study — “clinicaltrials.gov”

Identity

UniProt

P01343

Sequence

GPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Listed prices 14

What 13 shops we track listed for IGF-1, read from their own public catalogues on 2026-09-14. We take no commission on these and they are not ranked by any payment — how vendors are scored.