Metabolic & Weight Management

Cagrilintide

Cagrilintide is a manufactured amylin, the pancreatic fullness hormone, engineered to last: its half-life is about a week where the natural peptide is cleared in minutes. It exists mostly to be given with semaglutide, a combination called CagriSema, on the reasoning that two different satiety signals do more than one. A phase 2 trial put numbers on that: cagrilintide alone moved HbA1c by 0.9 percentage points, semaglutide alone by 1.8, and the pair by 2.2. The evidence behind it is substantial and recent, running to four phase 3 randomised trials across type 2 diabetes and obesity on top of a 706-person dose-finding study. No regulator has approved it, alone or in combination.

Last updated 12 August 2026

Studied forBody weight research · Appetite regulation research · Glycaemic control context

Evidence on file5 randomised human trials · 1 human observational study · 4 citations not yet graded

Strongest sourceCagrilintide-semaglutide (CagriSema) as an add-on to basal insulin in adults with type 2 diabetes (REIMAGINE… (randomised human trial)

Mechanism

Agonist at amylin AMY1 and AMY3 receptors in the hindbrain, and at the calcitonin receptor, reducing food intake.

Reported effects

What sources associate with this compound. Reported categories, not outcomes we have graded — each would need its own citation and rung.

Body weight research
Appetite regulation research
Glycaemic control context

Figures

Every figure below is replotted by this site from values published in the cited paper's text or tables — the numbers are the study's, the drawing is ours, and the evidence rung on each image is the rung of its source.

Weight change at week 26 — cagrilintide 4.5 mg phase 2 — Week 26, Mean body-weight change (%) by treatment — Data: Lau et al. 2021, Lancet (cagrilintide dose-finding) · n=706. Trial-product estimand. The full 0.3–4.5 mg dose ladder appears in the abstract only as a range (6.0%–10.8%), so intermediate doses are omitted rather than guessed.

Weight change at week 68 — REDEFINE 1 — Week 68, Estimated mean body-weight change at week 68 (%) by treatment — Data: Garvey et al. 2025, NEJM (REDEFINE 1) · n=3417 adults with overweight or obesity and without diabetes: 2108 cagrilintide-semaglutide, 302 semaglutide, 302 cagrilintide, 705 placebo. Estimated difference -17.3 percentage points (95% CI -18.1 to -16.6). The two monotherapy arms are not given numerically in the abstract, so they are not plotted. Gastrointestinal adverse events affected 79.6% vs 39.9%.

Cagrilintide-semaglutide vs semaglutide alone — REDEFINE 5 — Week 68, Estimated mean body-weight change at week 68 (%) by treatment — Data: Yamauchi et al. 2026, Lancet Diabetes Endocrinol (REDEFINE 5, Japan and Taiwan) · n=331 across 22 sites in Japan and Taiwan: 164 cagrilintide-semaglutide, 167 semaglutide. Active-controlled phase 3a, so there is no placebo arm. Published as -18.4% (SE 0.7) vs -11.9% (SE 0.7).

Dosing on file unverified

Titrate to 2.4 mg/week

Carried from a source that labels it unverified, and reproduced with that label attached. A record of what is reported, not a recommendation. No citation on this page establishes it.

What is circulated about this dose. One claim is recorded on this page with the page it was read from. Read what is circulated.

Half-life, storage & sport

Elimination half-life: 159-195 hours (human, SC) — study. phase 1b, cagrilintide 0.16-4.5 mg with semaglutide 2.4 mg, Lancet 2021.
Storage: not on file — no stability record on file — investigational, no label.
In sport (WADA 2026): Prohibited, at all times — S0 catch-all. the list Not named; investigational, no approval for human therapeutic use.

The half-life on file is 1.1 wk, measured subcutaneously. No dosing schedule could be read from this record, so the curve below is one dose drawn from the moment it is given. Nothing here says how often it is repeated.

One dose. 5.3 wk of decay, normalised to its own peak.

The rise is not modelled and the axis is not a blood level. No absorption rate constant and no volume of distribution are on file, so each dose appears at full height the instant it is given, and the axis is percent of this compound's own peak.

Literature on file 11

review or editorial
Cagrilintide plus semaglutide for obesity management (2021, cited 39x) graded on: indexed as "Comment" - secondary literature, not a study — “Comment”
human RCT
Cagrilintide-semaglutide (CagriSema) as an add-on to basal insulin in adults with type 2 diabetes (REIMAGINE 3): a randomised, double-blind, placebo-controlled, multicentre, phase 3 study. graded on: randomised and placebo-controlled — “randomised, double-blind, placebo-controlled”
human RCT
Efficacy and safety of once-weekly cagrilintide-semaglutide (CagriSema) in adults with type 2 diabetes inadequately controlled on diet and exercise (REIMAGINE 1): a randomised, double-blind, placebo-controlled, phase 3a study. graded on: randomised and placebo-controlled — “randomised, double-blind, placebo-controlled”
human RCT
Cagrilintide-semaglutide (CagriSema) versus semaglutide or cagrilintide in people with type 2 diabetes (REIMAGINE 2): a double-blind, randomised, controlled, phase 3 study. graded on: a randomised study — “randomised, controlled, phase 3 study”
human RCT
Efficacy and safety of co-administered cagrilintide and semaglutide versus semaglutide alone in adults with overweight or obesity with or without type 2 diabetes in Japan and Taiwan (REDEFINE 5): a multicentre, randomised, active-controlled, phase 3a trial. graded on: a randomised trial — “randomised, active-controlled, phase 3a trial”
human RCT
Renal or Hepatic Impairment Does Not Affect Pharmacokinetics, Safety, or Tolerability of Subcutaneous Cagrilintide. graded on: names a randomised controlled trial — the indexed publication type — “Randomized Controlled”
human observational
NCT04982575: Efficacy and Safety of Co-administration of Cagrilintide s.c. 2.4 mg and Semaglutide s.c. 2.4 mg Once Weekly in Subjects With Type 2 Diabetes graded on: a registered clinical study — “clinicaltrials.gov”

Not graded

4 citations whose study design could not be read from the title. Left ungraded rather than guessed at.

not graded
NCT05394519: Efficacy and Safety of Cagrilintide s.c. 2.4 mg in Combination With Semaglutide s.c. 2.4 mg (CagriSema s.c. 2.4 mg/2.4 mg) Once-weekly in Participants With Overweight or Obesity and Type 2 Diabetes graded on: NCT05394519 is completed and has posted no results - a registration, not a reported outcome — “NCT05394519”
not graded
NCT05813925: Efficacy and Safety of Cagrilintide S.C. 2.4 mg in Combination With Semaglutide S.C. 2.4 mg (CagriSema S.C. 2.4 mg/2.4 mg) Once-Weekly in East Asian Participants With Overweight or Obesity graded on: NCT05813925 is completed and has posted no results - a registration, not a reported outcome — “NCT05813925”
not graded
NCT05996848: Efficacy and Safety of Cagrilintide s.c. 2.4 mg in Combination With Semaglutide s.c. 2.4 mg (CagriSema s.c. 2.4 mg/2.4 mg) Once-Weekly in Chinese Participants With Overweight or Obesity graded on: NCT05996848 is completed and has posted no results - a registration, not a reported outcome — “NCT05996848”
not graded
NCT06065540: Efficacy and Safety of Co-administered Cagrilintide and Semaglutide (CagriSema) s.c. in Doses 2.4/2.4 mg and 1.0/1.0 mg Once Weekly Versus Semaglutide 2.4 mg and 1.0 mg, Cagrilintide 2.4 mg and Placebo in Participants With Type 2 Diabetes Inadequately Controlled on Metformin With or Without an SGLT2 Inhibitor graded on: NCT06065540 is completed and has posted no results - a registration, not a reported outcome — “NCT06065540”

What is circulated not evidence 4

Claims passed around in community guides and vendor copy, recorded because they circulate — not because they are true. Each is shown with the page it was read from and what this record actually holds. Checked 2026-08-24.

unverified community data titration common nothing on file either way

A 16-week escalation ladder to a 2.4 mg weekly target, in 4-week steps, is circulated as the standalone cagrilintide protocol.

It uses a 16-week escalation ladder so tolerability can be reviewed before the 2.4 mg weekly research-target dose.

On the record No dosing record exists on file for cagrilintide at all; the ladder is a community construction from trial arms.

Source 1
unverified community data stacking common nothing on file either way

Stacking cagrilintide with semaglutide to reproduce CagriSema at home is circulated, citing the REDEFINE 1 weight-loss figures as the rationale.

the combination produced 20.4% mean weight loss versus 11.8% for cagrilintide alone and 14.9% for semaglutide alone

On the record The record holds cagrilintide's own trial benefits (body weight, appetite regulation, glycaemic context); no co-formulation or home-stacking record exists.

Source 1
unverified community data storage common nothing on file either way

Vendor protocol pages state reconstituted cagrilintide keeps 28-30 days refrigerated and must not be frozen.

use within 28-30 days. Do not freeze the reconstituted solution.

On the record Storage on file: no stability record — investigational, no label. The circulated figure has no study behind it.

Source 1
unverified community data side effect common cannot be checked

High nausea and injection-site reaction rates from the phase 2 trial are circulated on vendor pages as expected side effects.

nausea occurred in 47% of participants, injection-site reactions in 43%

On the record The record holds trial-derived benefit and tolerability context; the specific percentage figures should be checked against the cited Lancet 2021 trial before any use.

Source 1

Identity

Space-filling 3D model of Cagrilintide, carbon grey, nitrogen blue, oxygen red — Built from the SMILES on this record — the atoms and bonds are exact. The shape is **one computed low-energy pose**, not a measured structure: a flexible peptide in solution has no single conformation, and where the SMILES leaves a stereocentre undefined the pose commits to one arbitrarily. The skeletal formula below claims connectivity and nothing more, which is what we actually know.

2D chemical structure of Cagrilintide — Built from the SMILES on this record — the atoms and bonds are exact. The shape is **one computed low-energy pose**, not a measured structure: a flexible peptide in solution has no single conformation, and where the SMILES leaves a stereocentre undefined the pose commits to one arbitrarily. The skeletal formula below claims connectivity and nothing more, which is what we actually know.

Molecular weight: 4409
Molecular formula: C194H312N54O59S2
CAS number: 1415456-99-3
PubChem CID: 171397054
UniProt: P10997
InChI key: LDERDVMBIYGIOI-IZVMHKDJSA-N
Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP
SMILES: CC[C@H](C)[C@@H](C(=O)N[C@H](CC(C)C)C(=O)N1CCC[C@@H]1C(=O)N2CCC[C@@H]2C(=O)N[C@H]([C@H](C)O)C(=O)N[C@H](CC(=O)N)C(=O)N[C@H](C(C)C)C(=O)NCC(=O)N[C@H](CO)C(=O)N[C@H](CC(=O)N)C(=O)N[C@H]([C@H](C)O)C(=O)N3CCC[C@@H]3C(=O)N)NC(=O)[C@@H]4CCCN4C(=O)CNC(=O)[C@H](CC5=CC=CC=C5)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CC(=O)N)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H](CC6=CNC=N6)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC7=CC=CC=C7)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@@H](C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@H](CCCNC(=N)N)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](C)NC(=O)[C@@H]8CSSC[C@@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N[C@H](C(=O)N8)[C@@H](C)O)C)[C@@H](C)O)CC(=O)N)NC(=O)[C@H](CCCCN)NC(=O)CC[C@@H](C(=O)O)NC(=O)CCCCCCCCCCCCCCCCCCC(=O)O
InChI: InChI=1S/C194H312N54O59S2/c1-19-100(10)151(184(298)233-128(78-98(6)7)189(303)248-75-49-60-137(248)190(304)247-74-48-59-136(247)182(296)243-155(107(17)255)187(301)232-127(86-143(201)262)173(287)238-150(99(8)9)183(297)210-88-146(265)218-129(90-249)176(290)230-126(85-142(200)261)175(289)244-156(108(18)256)191(305)246-73-46-57-134(246)157(202)271)239-181(295)135-58-47-72-245(135)147(266)89-211-161(275)120(79-109-50-36-34-37-51-109)225-171(285)123(82-139(197)258)228-172(286)124(83-140(198)259)229-177(291)130(91-250)235-178(292)131(92-251)234-170(284)122(81-111-87-207-95-212-111)227-164(278)114(56-45-71-209-194(205)206)221-168(282)119(77-97(4)5)224-169(283)121(80-110-52-38-35-39-53-110)226-166(280)116(65-68-149(269)270)219-158(272)101(11)213-167(281)118(76-96(2)3)223-163(277)113(55-44-70-208-193(203)204)220-165(279)115(63-66-138(196)257)222-186(300)153(105(15)253)240-159(273)102(12)214-179(293)132-93-308-309-94-133(180(294)231-125(84-141(199)260)174(288)242-152(104(14)252)185(299)215-103(13)160(274)241-154(106(16)254)188(302)237-132)236-162(276)112(54-42-43-69-195)216-145(264)67-64-117(192(306)307)217-144(263)61-40-32-30-28-26-24-22-20-21-23-25-27-29-31-33-41-62-148(267)268/h34-39,50-53,87,95-108,112-137,150-156,249-256H,19-33,40-49,54-86,88-94,195H2,1-18H3,(H2,196,257)(H2,197,258)(H2,198,259)(H2,199,260)(H2,200,261)(H2,201,262)(H2,202,271)(H,207,212)(H,210,297)(H,211,275)(H,213,281)(H,214,293)(H,215,299)(H,216,264)(H,217,263)(H,218,265)(H,219,272)(H,220,279)(H,221,282)(H,222,300)(H,223,277)(H,224,283)(H,225,285)(H,226,280)(H,227,278)(H,228,286)(H,229,291)(H,230,290)(H,231,294)(H,232,301)(H,233,298)(H,234,284)(H,235,292)(H,236,276)(H,237,302)(H,238,287)(H,239,295)(H,240,273)(H,241,274)(H,242,288)(H,243,296)(H,244,289)(H,267,268)(H,269,270)(H,306,307)(H4,203,204,208)(H4,205,206,209)/t100-,101+,102-,103-,104+,105+,106+,107-,108-,112-,113-,114-,115-,116-,117-,118+,119-,120-,121-,122-,123-,124-,125-,126+,127+,128+,129+,130-,131-,132-,133-,134+,135-,136+,137+,150+,151-,152-,153-,154-,155+,156+/m0/s1

Also called

cagri
cagrilinitide
cag

Notes unverified prose

Phase 2; Phase 2/3; REDEFINE trials

Not on file 0

All 8 tracked fields hold a value on this record: molecular weight and formula, CAS number, PubChem CID, amino-acid sequence, SMILES, InChI and InChI key.

Counted from the record itself, not from what a source said it was missing. 163 of 188 records still have at least one empty.

Listed prices 169

What 104 shops we track listed for Cagrilintide, read from their own public catalogues on 2026-09-14. We take no commission on these and they are not ranked by any payment — how vendors are scored.

Compare prices169 listings from 104 shops

Listed in USD
Vendor	Size	Price	Per mg
Step One Ventures	10 mg	$49.00 USD	$4.90/mg
IDUN Peptides	10 mg	$49.99 USD	$5.00/mg
Novaglo Research	5 mg	$25.00 USD	$5.00/mg
Novaglo Research	10 mg	$50.00 USD	$5.00/mg
Peptide Partners	200 mg	$1050.00 USD	$5.25/mg
research1peptides	10 mg	$55.00 USD	$5.50/mg
Peptide Partners	150 mg	$835.00 USD	$5.57/mg
Step One Ventures	5 mg	$29.00 USD	$5.80/mg
research1peptides	5 mg	$30.00 USD	$6.00/mg
Peptide Partners	100 mg	$610.00 USD	$6.10/mg
Elite Edge Biotech	10 mg	$63.00 USD ~~$126.00 USD~~	$6.30/mg
AMC Essentials	20 mg	$129.99 USD	$6.50/mg
Rejuven8 Peptides	10 mg	$65.00 USD ~~$80.00 USD~~	$6.50/mg
Peptide Partners	50 mg	$335.00 USD	$6.70/mg
Evolve BioPep	5 mg	$34.99 USD	$7.00/mg
Double R Labs	10 mg	$69.99 USD ~~$89.99 USD~~	$7.00/mg
Modified Aminos	10 mg	$69.99 USD	$7.00/mg
Forge Performance Co	10 mg	$70.00 USD	$7.00/mg
Try Hero Research	10 mg	$70.00 USD ~~$85.00 USD~~	$7.00/mg
AMC Essentials	20 mg	$144.99 USD	$7.25/mg
Puratek Peptides	10 mg	$72.95 USD	$7.29/mg
Go Alpha Labs	10 mg	$74.99 USD ~~$99.99 USD~~	$7.50/mg
GenPeptide	5 mg	$40.00 USD	$8.00/mg
Crownwell Research	10 mg	$80.00 USD	$8.00/mg
ezPeps	11 mg	$94.99 USD ~~$119.99 USD~~	$8.64/mg
Legendary Peptides	10 mg	$87.00 USD	$8.70/mg
EZ Peptides	5 mg	$44.00 USD	$8.80/mg
Ameano Peptides	10 mg	$88.00 USD	$8.80/mg
EZ Peptides	10 mg	$88.00 USD	$8.80/mg
peptidegiants.com	10 mg	$89.99 USD	$9.00/mg
Trusted Aminos	10 mg	$89.99 USD	$9.00/mg
Royal Peptides	10 mg	$90.00 USD	$9.00/mg
Triumphant Labs	10 mg	$90.00 USD	$9.00/mg
Puratek Peptides	5 mg	$45.95 USD	$9.19/mg
Athena Peptides	10 mg	$95.00 USD	$9.50/mg
Oath Peptides	10 mg	$95.00 USD ~~$195.00 USD~~	$9.50/mg
Oath Research	10 mg	$95.00 USD ~~$195.00 USD~~	$9.50/mg
Modern Aminos	10 mg	$95.20 USD	$9.52/mg
Oneday Compounds	5 mg	$47.99 USD ~~$59.99 USD~~	$9.60/mg
peptidegiants.com	5 mg	$48.00 USD	$9.60/mg
Ameano Peptides	5 mg	$49.00 USD	$9.80/mg
Ion Peptide	10 mg	$99.00 USD	$9.90/mg
Xcel Peptides ships worldwide	10 mg	$99.00 USD	$9.90/mg
Fusion Peptide	8 mg	$79.99 USD	$10.00/mg
Rivn Peptides	10 mg	$99.99 USD	$10.00/mg
Titan X Research	10 mg	$99.99 USD	$10.00/mg
Valor Peptides	10 mg	$99.99 USD	$10.00/mg
PeakForm Peptides	10 mg	$100.00 USD	$10.00/mg
Peptides Warehouse	10 mg	$101.59 USD	$10.16/mg
aminousa	10 mg	$102.00 USD ~~$170.00 USD~~	$10.20/mg
Treasure Coast Solutions	5 mg	$51.50 USD ~~$79.99 USD~~	$10.30/mg
AMC Essentials	15 mg	$154.99 USD	$10.33/mg
Licensed Peptides	10 mg	$109.99 USD	$11.00/mg
Platinum Lion Peptides	10 mg	$109.99 USD ~~$125.00 USD~~	$11.00/mg
Vortex Research	10 mg	$109.99 USD ~~$139.99 USD~~	$11.00/mg
Athena Peptides	5 mg	$55.00 USD	$11.00/mg
milehighpeptides.com	5 mg	$55.00 USD	$11.00/mg
Peptide Crafters	10 mg	$110.00 USD	$11.00/mg
aminousa	5 mg	$57.00 USD ~~$95.00 USD~~	$11.40/mg
Modern Aminos	8 mg	$93.60 USD	$11.70/mg
Ion Peptide	5 mg	$59.00 USD	$11.80/mg
PeakForce Labs	5 mg	$59.00 USD ~~$85.00 USD~~	$11.80/mg
Hero Peptides	10 mg	$119.00 USD	$11.90/mg
Peptira	10 mg	$119.00 USD	$11.90/mg
Pure Peptide Labs	5 mg	$59.95 USD	$11.99/mg
Life Peptides	10 mg	$119.95 USD	$11.99/mg
Pure Peptide Labs	10 mg	$119.95 USD	$11.99/mg
Soma Chems	5 mg	$59.99 USD	$12.00/mg
PeakForm Peptides	5 mg	$60.00 USD ~~$70.00 USD~~	$12.00/mg
Purus Peptides	5 mg	$60.00 USD	$12.00/mg
Jade Nexus	10 mg	$120.00 USD	$12.00/mg
Licensed Peptides	10 mg	$122.99 USD	$12.30/mg
Trulab Peptides	5 mg	$62.00 USD	$12.40/mg
Nationwide Peptides	10 mg	$124.00 USD	$12.40/mg
Soma -	10 mg	$124.00 USD	$12.40/mg
AMC Essentials	10 mg	$124.99 USD	$12.50/mg
PSPeptides	10 mg	$125.99 USD	$12.60/mg
Certified Peptides	10 mg	$128.00 USD	$12.80/mg
Arizona Peptides (.us)	5 mg	$65.00 USD ~~$75.00 USD~~	$13.00/mg
Arizona Peptides USA	5 mg	$65.00 USD ~~$75.00 USD~~	$13.00/mg
Nationwide Peptides	5 mg	$65.00 USD	$13.00/mg
Peptide Crafters	5 mg	$65.00 USD ~~$90.00 USD~~	$13.00/mg
Pivot labs	10 mg	$130.00 USD	$13.00/mg
My GLP 1 Store	10 mg	$132.00 USD	$13.20/mg
Pure Bio Labs	10 mg	$134.99 USD	$13.50/mg
Hero Peptides	5 mg	$69.00 USD	$13.80/mg
Transforma Peptides	5 mg	$69.00 USD	$13.80/mg
Transforma Peptides	10 mg	$139.00 USD	$13.90/mg
Liberty Peptides	5 mg	$72.00 USD	$14.40/mg
My GLP 1 Store	5 mg	$72.00 USD	$14.40/mg
Valkyrie Peptides	10 mg	$145.00 USD	$14.50/mg
Pure Lab Peptides	10 mg	$149.99 USD	$15.00/mg
Florida Peptides	10 mg	$150.00 USD	$15.00/mg
Peptides.GG	10 mg	$155.00 USD	$15.50/mg
Protide Health	10 mg	$155.00 USD	$15.50/mg
Paramount Peptides	10 mg	$157.25 USD	$15.72/mg
Pure Lab Peptides	5 mg	$79.99 USD	$16.00/mg
Umbrella Labs	5 mg	$79.99 USD	$16.00/mg
Vital Core Research	10 mg	$159.99 USD	$16.00/mg
Florida Peptides	5 mg	$80.00 USD	$16.00/mg
Oasis Labs	5 mg	$81.00 USD	$16.20/mg
Pivot labs	5 mg	$85.00 USD	$17.00/mg
pepvidalabs	10 mg	$170.00 USD	$17.00/mg
USA Peptide Sciences	10 mg	$170.00 USD	$17.00/mg
Jade Nexus	5 mg	$87.00 USD	$17.40/mg
Modern Peptides	10 mg	$178.00 USD	$17.80/mg
PSPeptides	5 mg	$89.99 USD	$18.00/mg
pepvidalabs	5 mg	$90.00 USD	$18.00/mg
Pure Bio Labs	5 mg	$94.99 USD	$19.00/mg
Protide Health	5 mg	$95.00 USD	$19.00/mg
Pivot labs	10 mg	$195.00 USD	$19.50/mg
Xcel Peptides ships worldwide	5 mg	$99.00 USD	$19.80/mg
Vital Core Research	4 mg	$79.99 USD	$20.00/mg
AMC Essentials	20 mg	$399.99 USD	$20.00/mg
Peptides.GG	5 mg	$100.00 USD	$20.00/mg
BioGenix Peptides	5 mg	$105.00 USD	$21.00/mg
Modern Peptides	5 mg	$105.00 USD	$21.00/mg
Fusion Peptide	5 mg	$106.99 USD	$21.40/mg
PeptidesKingdom	10 mg	$215.00 USD	$21.50/mg
Licensed Peptides	5 mg	$107.99 USD	$21.60/mg
Vital Core Research	10 mg	$225.99 USD	$22.60/mg
milehighpeptides.com	5 mg	$119.00 USD	$23.80/mg
PeptidesKingdom	5 mg	$125.00 USD	$25.00/mg
Umbrella Labs	5 mg	$129.99 USD	$26.00/mg
Licensed Peptides	10 mg	$273.87 USD	$27.39/mg
Vital Core Research	4 mg	$110.99 USD	$27.75/mg
Regentide	5 mg	$144.99 USD ~~$170.00 USD~~	$29.00/mg
Pivot labs	5 mg	$149.00 USD	$29.80/mg
Perform Peptides	10 mg	$299.00 USD	$29.90/mg
Fusion Peptide	2.5 mg	$80.99 USD	$32.40/mg
Licensed Peptides	10 mg	$384.96 USD	$38.50/mg
Jade Nexus	10 mg	$430.00 USD	$43.00/mg
Jade Nexus	5 mg	$310.00 USD	$62.00/mg
Licensed Peptides	10 mg	$626.94 USD	$62.69/mg
Fusion Peptide	1.4 mg	$160.99 USD	$114.99/mg
Eternal Peptides	size not listed	$46.99 USD ~~$69.99 USD~~	—
BioEdge Research Labs	size not listed	$59.00 USD	—
Eternal Peptides	size not listed	$64.99 USD ~~$89.99 USD~~	—
VANDL Labs	size not listed	$79.99 USD	—
milehighpeptides.com	size not listed	$89.00 USD	—
ONYX BIOLABS	size not listed	$94.99 USD ~~$129.99 USD~~	—
Mile High Compounds	size not listed	$119.99 USD ~~$129.99 USD~~	—
TCORE BIOTECH	size not listed	$129.99 USD	—
PeptidesKingdom	size not listed	$155.00 USD ~~$185.00 USD~~	—
American Peptides	size not listed	$170.00 USD	—
Vital Core Research	size not listed	$232.99 USD	—
Royal Peptides	size not listed	$300.00 USD	—
PeptideTest	size not listed	$400.00 USD	—
Royal Peptides	size not listed	$465.00 USD	—

Listed in CAD
Vendor	Size	Price	Per mg
Panda Peptide	10 mg	$79.99 CAD	$8.00/mg
Nox Peptides	10 mg	$99.99 CAD	$10.00/mg
VPeptide Canada	10 mg	$99.99 CAD	$10.00/mg
Great Northern Peptides	10 mg	$100.00 CAD	$10.00/mg
PeptideProCanada	10 mg	$100.00 CAD ~~$125.00 CAD~~	$10.00/mg
Riptide Peptides	10 mg	$100.00 CAD	$10.00/mg
Panda Peptide	5 mg	$50.99 CAD	$10.20/mg
Peptigo	5 mg	$55.00 CAD	$11.00/mg
Peptide Cart	5 mg	$59.99 CAD	$12.00/mg
Peptide Shop Canada	10 mg	$127.50 CAD	$12.75/mg
Luxara Labs	10 mg	$130.00 CAD	$13.00/mg
Canada Steroid Depot	11 mg	$146.30 CAD	$13.30/mg
Ronin Peptides	10 mg	$139.99 CAD	$14.00/mg
Peptide Shop Canada	5 mg	$72.50 CAD	$14.50/mg
Toronto Peptides	10 mg	$150.00 CAD	$15.00/mg
Luxara Labs	5 mg	$80.00 CAD	$16.00/mg
Black Helix Labs	10 mg	$170.00 CAD	$17.00/mg
Toronto Peptides	5 mg	$100.00 CAD ~~$132.00 CAD~~	$20.00/mg
Canada Steroid Depot	10 mg	$214.99 CAD	$21.50/mg
Canadian Anabolics	size not listed	$90.00 CAD	—

Prices are the vendor's own listing, reproduced with the date we read it — never converted between currencies, and compared per milligram only where the vendor states the vial size.

At a glance

Strongest rung: human RCT
Citations: 11
Regulatory: Human research reported (unverified)
Route: Subcutaneous
Declared gaps: 0

Running this

GLP-1 and incretin

How the class is run, with the source of every schedule beside it.

Citations by rung

Strongest wins, never an average.