PEPTIDE CORPUS

Metabolic & Weight Management

Adiponectin

Adiponectin is a hormone that fat tissue itself releases, telling muscle and liver to burn fatty acids and take up glucose through the AMPK and PPAR-alpha pathways. It is one of the molecules that turned body fat from inert padding into a recognised endocrine organ, and the literature followed: nearly 83,000 papers carry the name, almost 39,000 of them since 2020. Almost all of that is measurement rather than medicine, with adiponectin read off a blood test as a marker of insulin sensitivity and cardiometabolic risk. Every human study on file is observational, and the one administered version, a receptor agonist, has reached Phase 1.

Last updated

Studied forInsulin sensitivity research · Metabolic marker context · Vascular inflammation research
Evidence on file2 human observational studies · 1 animal study · 5 citations not yet graded
Strongest sourceDivergent responses of adiponectin and leptin to exercise in women with overweight or obesity: a systematic r… (human observational study)

Mechanism

Signals at AdipoR1 and AdipoR2 to activate AMPK and PPAR-alpha, raising fatty-acid oxidation and glucose uptake.

Reported effects

What sources associate with this compound. Reported categories, not outcomes we have graded — each would need its own citation and rung.

  • Insulin sensitivity research
  • Metabolic marker context
  • Vascular inflammation research

Dosing on file unverified

PEG-BHD1028: SAD 4-64 µg/kg, MAD 8-32 µg/kg QD for 28 days

Carried from a source that labels it unverified, and reproduced with that label attached. A record of what is reported, not a recommendation. No citation on this page establishes it.

Literature on file 11

Not graded

5 citations whose study design could not be read from the title. Left ungraded rather than guessed at.

Identity

Sequence
ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN

Notes unverified prose

Phase 1; (PEG)-BHD1028 Phase 1 (adiponectin agonist)

Not on file 8

7 of the 8 fields we track hold nothing on this record, and each says why. 1 further absence is named below. A blank field is a bug; a named absence is a finding.

Each field links to every other record missing the same thing. The full ledger holds 765 gaps across 163 records.